GLP-1 5mg/vial Achieve Effective Weight Management And Blood Sugar Control

GLP-1 5mg/bottle core introduction

Research-grade glucagon-like peptide-1 | Made in China human GLP-1(7-36)amide 5mg/vial

Generic name : Glucagon-like peptide-1 (active form)

English name : Glucagon-like peptide-1 (7-36) amide

Amino acid sequence : HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ (positions 7-36, C-terminal amidation)

CAS No .: 106612-94-6

Molecular formula : C₁₄₇H₂₂₀N₄₂O₄₅

Molecular weight : Approximately 3297.6 Da

Purity : ≥98.0% (HPLC)

Appearance : White lyophilized powder

Storage : Freeze at -20℃, protect from light, and store in a dry place.

Usage and Storage Guide

1. Reconstitution and preparation :

Recommended solvent :

Preferred solvent : Alkaline buffer solution with pH 8.5-9.0 (such as 0.1M NH₄HCO₃ buffer) or dedicated sterile reconstitution diluent.

Secondary solvent : Sterile water for injection (Note that GLP-1 tends to form gels or aggregate in aqueous solutions; it should be used immediately after dissolution).

For cell experiments : dissolve in a small amount of dilute acetic acid (e.g., 0.1% acetic acid aqueous solution) first, then dilute with PBS or culture medium to the working concentration.

Standard preparation procedure :

Solvent preparation :

Bring the recommended buffer or sterile water to room temperature.

If using sterile water, it is recommended to add a small amount (0.1%) of bovine serum albumin (BSA) to reduce peptide adsorption on the container surface.

Reconstitution procedure :

Add 1.0 mL of solvent to a 5 mg vial.

Gently rotate the vial (do not shake vigorously).

Let stand at room temperature for 2-3 minutes until completely dissolved.

Final concentration: 5 mg/mL (approximately 1.5 mM)

Separate and store :

Immediately aliquot the solution into smaller portions (e.g., 20-50 μL/tube).

Immediately freeze after repackaging.

Preparation of working solution :

In vitro cell experiments : The typical working concentration is 1-100 nM.

Animal studies : Intraperitoneal injection dose 5-50 μg/kg, diluted with physiological saline or PBS.

Note : Avoid repeated freeze-thaw cycles; single-use repackaging is recommended.

Key points to note :

Dissolving tips : If dissolving is difficult, gently vortex, but avoid vigorous shaking that may generate bubbles.

pH control : An alkaline environment (pH>8.0) is beneficial for dissolution and stability.

Adsorption prevention : Use tubing with low adsorption properties (such as silanized tubing).

To avoid contamination : Strict aseptic technique must be followed during the preparation process.

Use immediately : Use within 1 hour after reconstitution.

2. Storage conditions :

Unreconstituted lyophilized powder :

Long-term storage : Store frozen at -20°C or below; shelf life 24 months.

Optimal storage : Deep freezing at -80°C can extend stability to 36 months.

Conditions to avoid : Avoid repeated freeze-thaw cycles, and protect from high temperatures and sunlight.

Reconstituted solution :

Use immediately : Best used immediately after reconstitution.

Short-term storage : Refrigerate at 2-8℃ for no more than 4 hours.

Long-term storage : After repackaging, freeze at -20℃ for no more than 1 month, or at -80℃ for no more than 3 months.

Transportation conditions :

Freeze-dried powder : Transported with ice packs (2-8℃) or dry ice (below -78℃).

Solution : Must be transported with dry ice.

Light-proof packaging : Wrapped in light-proof materials

3. Stability protection measures :

Antioxidant protection :

Add 0.1% ascorbic acid or 1mM EDTA

Nitrogen purging protection solution

Protease inhibitors :

Add 0.1% aprotinin or 1mM PMSF

The preparation process is carried out on ice.

Concentration maintenance :

Working concentration not less than 10 μM

Avoid prolonged storage after high dilution

Container selection :

Using silanized low-adsorption tubes

Avoid using polypropylene tubing (it easily absorbs moisture).

4. Compatibility and fit :

Compatible solvents :

0.1M NH₄HCO₃ buffer

0.1% acetic acid solution

PBS (pH 7.4, short-term)

Physiological saline containing 0.1% BSA

Avoid incompatibility :

Strong acid (pH < 3.0)

Strong base (pH>10.0)

High concentration organic solvents

Metal ions (Cu²⁺, Fe³⁺)

Quality Advantages of Chinese Manufacturers

This product is manufactured by a Chinese biotechnology company, strictly adheres to cGMP standards, and is designed specifically for research needs.

✅Advanced synthesis process :

Solid-phase peptide synthesis : using the Fmoc strategy, amino acid-by-amino acid coupling.

Proprietary modification technology : C-terminal amidation efficiency ≥99.5%

Microwave-assisted synthesis : Improves coupling efficiency and reduces missing sequences

Large-scale production : batch output in grams, ensuring stable supply.

✅Strict quality control :

Purity analysis :

HPLC purity ≥ 98.0%

Single impurity ≤0.5%

Total impurities ≤ 2.0%

Molecular weight confirmation :

MALDI-TOF MS precise measurement

Error range ±0.1%

Secondary structure :

Circular dichroism (CD) analysis

Confirmation of α-helical structure

Bioactivity verification :

cAMP detection based on RINm5F cells

EC₅₀≤0.1nM

Maximum effect ≥90%

Sterility and endotoxins :

Sterility test: Meets requirements

Bacterial endotoxin: <10 EU/mg

Moisture content :

Moisture content: ≤5.0%

Peptide content: ≥80.0%

✅Stability Guaranteed :

Accelerated testing : Stability at 40℃/75%RH

Long-term test : Stable for 24 months when stored at -20℃

Repeated freeze-thaw cycles : withstands 3 freeze-thaw cycles

Light test : Stable under light-shielded conditions

✅Professional Packaging :

Vials : Neutral borosilicate glass, light-proof treatment

Rubber stopper : Coated butyl rubber stopper

Nitrogen purging protection : to prevent oxidation

Individual packaging : to avoid cross-contamination

Complete label : batch number, purity, concentration, expiration date

✅Technical Support :

Provide a complete COA report

Technical consultation and support

Custom synthesis service

Application Solution Guidance

Need anything, please contact us

Hot Tags: glp-1 5mg/vial achieve effective weight management and blood sugar control, China glp-1 5mg/vial achieve effective weight management and blood sugar control manufacturers, suppliers, factory, AOD9604 Ideal For Competition Prep Peak Weeks, ace 031 1mg, buy aod 9604 pills, peptide cjc ipamorelin, Alternative to GHRP 6, hgh ipamorelin