PEG-MGF 2mg/vial core introduction
Polyethylene glycol-modified mechanical growth factor | Muscle repair and growth peptide 2mg/bottle
Generic name : Polyethylene glycol-modified mechanical growth factor
English name : PEG-MGF (PEGylated Mechano Growth Factor)
Sequence : YQPPSTNKNTKSQRRKGSTFEEHKISNLEKERINQR
Molecular weight : Approximately 12,000 Da
Purity : ≥98.0% (HPLC)
Content : 2mg/bottle
Appearance : White lyophilized powder
Storage : Freeze at -20℃, protect from light, and store in a dry place.
Usage and Storage Guide
PEG-MGF (polyethylene glycol-modified mechanical growth factor):
PEG-MGF is a splice variant of insulin-like growth factor-1 (IGF-1) that has a prolonged half-life and enhanced bioavailability through polyethylene glycol modification. Unlike natural IGF-1, PEG-MGF is tissue-specific, primarily acting on skeletal muscle tissue. It promotes satellite cell proliferation and differentiation by activating IGF-1 receptors, thereby stimulating muscle repair and growth. In experimental studies, PEG-MGF has demonstrated its ability to promote muscle satellite cell activation, muscle fiber hypertrophy, and damage repair, making it valuable for studying muscle regeneration, exercise adaptation, and anti-muscle atrophy mechanisms.
Due to its specific effects on muscle tissue and long-lasting properties, PEG-MGF has received widespread attention in exercise physiology, muscle injury repair, and anti-muscle atrophy research. In experimental models that require assessment of muscle repair capacity, post-exercise recovery rate, and muscle mass maintenance, PEG-MGF serves as a standardized research tool, providing an experimental basis for exploring muscle regeneration mechanisms and exercise adaptation.
Applications of PEG-MGF:
As a long-acting muscle-specific growth factor, it is mainly used to study its effects on muscle satellite cell activation, muscle fiber hypertrophy, and injury repair, and to evaluate its regulatory role in muscle mass, strength, and recovery capacity in experimental models. It is an indispensable research tool for exploring muscle regeneration mechanisms, exercise adaptation, and anti-muscle atrophy research.
It has been applied in exercise physiology research, muscle injury repair experiments, anti-muscle atrophy research, and exploration of muscle regeneration mechanisms to study the potential regulatory effects of PEG-MGF on muscle growth, repair, and functional recovery under strictly controlled experimental conditions.
Usage and Storage Methods
1. Reconstitution and preparation :
Recommended solvent :
Preferred solvent : sterile water for injection
Carrier solution : diluted with sterile physiological saline for in vivo studies.
Important note : Avoid using strong acid or strong alkali solutions. This peptide is more stable under neutral conditions.
Standard preparation procedure :
Solvent preparation :
Use sterile water for injection that has been aseptically filtered through a 0.22 μm filter membrane.
The solvent temperature was restored to room temperature (20-25℃).
Reconstitution procedure :
Add 1.0 mL of sterile water for injection to a 2 mg vial.
Pour slowly along the bottle wall to avoid direct impact on the powder.
Gently rotate the vial for 3-5 minutes until completely dissolved and the solution becomes clear.
Final concentration: 2 mg/mL.
Dispensing and dilution :
Immediately dispense into single-use doses of 20-50 μL using low-adsorption cryovials.
Dilute with sterile saline to the required working concentration.
Clearly label: name, concentration, preparation date, batch number, and storage conditions.
Working concentration/dosage reference :
In vitro experiments : The commonly used concentration range is 10 ng/mL to 1 μg/mL, and preliminary experiments need to be performed to optimize the concentration based on the specific experimental system.
Animal experiments :
Local intramuscular injection : The usual dosage range is 10 to 100 μg/site.
Subcutaneous injection : The usual dose range is 0.1 to 1 mg/kg.
It is strongly recommended that the precise dosage be determined based on the specific animal model, route of administration, research objectives, and published literature.
Example of preparation calculation : If a 100 μg/mL working solution is required, take 0.05 mL of stock solution and add it to 0.95 mL of physiological saline.
Key points to note :
Strict aseptic technique : Operate in a clean bench and use sterile consumables, especially when administering drugs in vivo.
Avoid light : It is sensitive to light, so it is recommended to operate it in a dark environment.
Prepare and use immediately : After reconstitution, it should be used within 24 hours. After dispensing, store under the specified conditions.
Avoid adsorption : Using silanized low-adsorption tubes can reduce adsorption loss on the tube wall.
2. Storage conditions :
Unreconstituted lyophilized powder :
Long-term storage : Freeze at -20℃, shelf life 24 months.
Optimal storage : -80°C deep freeze, shelf life 36 months.
Strictly protected from light : Must be stored in the original light-proof aluminum foil bag.
Moisture protection : Keep dry; contains desiccant.
Reconstituted solution :
Use immediately : For best activity, use immediately after reconstitution.
Short-term storage : Refrigerate at 2-8℃ away from light, for no more than 24 hours.
Repackage and freeze : Store at -20℃ or -80℃ away from light for no more than 72 hours.
Repeated freeze-thaw cycles are strictly prohibited : a maximum of one freeze-thaw cycle.
Transportation conditions :
Freeze-dried powder : transported by dry ice (-78℃).
Short-term shipping : 2-8℃ ice pack shipping, ensuring delivery within 48 hours.
3. Stability and Processing Standards :
Chemical and physical stability :
It is relatively stable in neutral pH aqueous solutions.
Avoid contact with strong acids, strong alkalis, and oxidizing agents.
It is sensitive to high temperatures, so low-temperature storage is recommended.
Maintenance of bioactivity :
Proper storage conditions and appropriate preparation methods are key to maintaining activity.
To avoid repeated freeze-thaw cycles, it is recommended to store the contents in smaller portions.
Need anything, please contact us
|
|
+852 4671 8216 |
|
Telegram |
Allenraws |
|
|
Allenraws810@gmail.com |

Hot Tags: peg-mgf 2mg/vial it specifically promotes the repair, growth, and hypertrophy of muscle tissue, China peg-mgf 2mg/vial it specifically promotes the repair, growth, and hypertrophy of muscle tissue manufacturers, suppliers, factory, AOD9604 Ideal For Competition Prep Peak Weeks, ace 031 1mg, buy aod 9604 pills, peptide cjc ipamorelin, Alternative to GHRP 6, hgh ipamorelin

