Description

Technical Parameters

HGH 191 Amino Acids 10IU/bottle: Key Product Introduction

Pharmaceutical-grade peptide formulation | Chinese-made growth hormone (191 amino acid sequence )

Chemical name : Human growth hormone (191 amino acids)

Sequence : FPAMPLSSLFANAVLRAQHLHQLAADTFKEFER

TIPEGQQKQFKDHKHKSQDM

SRDISLLNQSVEELLKMIEKL

ELIVCTASLFDNKVQTYCGQ

AQKPSE

CAS No .: 12629-01-5

Specification : 10 IU/bottle

Dosage form : Lyophilized powder for injection

Molecular weight : 22,124 Da

Appearance : White freeze-dried lumpy powder

Purity : ≥98% (HPLC detection)

Storage conditions : Store at 2-8℃ away from light.

Core Effects

HGH 191 amino acid is a recombinant human growth hormone that is widely used in the treatment of growth hormone deficiency, anti-aging medicine, and sports medicine due to its complete 191 amino acid sequence and natural structure .

✅Multiple mechanisms of action :

Growth-promoting effects : Promotes bone and soft tissue growth through IGF-1 mediation.

Metabolic regulation : Promotes protein synthesis and regulates fat and glucose metabolism.

Cell repair : Stimulates cell proliferation and repair, delaying aging.

✅Quality advantages of Chinese manufacturing :

Complete sequence : 191 amino acid sequence, consistent with natural pituitary growth hormone.

Activity Guarantee : Bioactivity ≥3.0 IU/mg, meeting pharmacopoeia standards.

Excellent purity : RP-HPLC purity ≥98%, SEC purity ≥99%.

✅Global supply assurance :

Cold chain logistics : 2-8℃ cold chain transportation throughout the process to ensure stable activity.

Multi-warehouse delivery : Temperature-controlled warehouses in China, Europe, America, and the Asia-Pacific region ensure delivery within 5 days.

Customs clearance support : Complete export documents such as COA and MSDS

Production process and quality assurance

1. Advanced production technology :

Recombinant technology : Using an E. coli expression system, expression level > 5 g/L

Refolding technique : Gradient dialysis refolding, correct folding rate >95%

Purification process : Three-step purification: ion exchange + hydrophobic chromatography + molecular sieve.

2. Strict quality control standards :

Physicochemical properties :

RP-HPLC purity: main peak area ≥98%

SEC-HPLC: Polymer ≤1%, Monomer ≥99%

Isoelectric point: pI 5.0-5.3

Biological activity :

In vivo bioassay: Tibial weight gain method in pituitary-deprived rats

In vitro activity: Nb2 cell proliferation assay

3. Stability data :

Long-term stability : ≥90% activity is maintained after 24 months of storage at 2-8℃.

Accelerated test : After 3 months of storage at 25°C, the activity decreased by ≤5%.

Stability in use : After reconstitution, storage at 2-8℃ for 24 hours maintains an activity of ≥95%.

Scientific Research Applications and Clinical Prospects

1. Mechanism of action study :

Signaling pathway : Activation of the JAK2-STAT5 pathway, promoting gene transcription

Metabolic regulation : regulating glucose transport and lipolysis

Cell proliferation : promotes cell mitosis and protein synthesis.

2. Research and application areas :

Endocrinology : Growth hormone deficiency, adult growth hormone deficiency

Anti-aging medicine : Prevention and treatment of age-related functional decline

Sports medicine : Promoting the improvement and recovery of athletes' body composition

3. Preclinical data :

Growth promotion : Children with growth hormone deficiency may experience a 2-3 times increase in height.

Body composition : Adult patients show increased lean body mass and decreased body fat.

Quality of life : Improves energy, skin quality, and cardiovascular risk factors

The Quality Advantages of Made in China

1. Advantages in manufacturing process :

Expression system : High-density fermentation technology, high expression level

Refolding process : Patented refolding technology, high accuracy in folding.

Purification process : Three-step chromatography purification to remove host proteins and DNA.

2. Quality Assurance System :

Compliant with standards : Meets Chinese Pharmacopoeia, USP, and EP standards.

Virus safety : Rigorous verification of virus removal/inactivation

Batch consistency : Advanced process control ensures consistency between batches.

3. Global supply network :

Production Base : GMP-compliant production base in China

Cold chain network : a temperature-controlled logistics network covering the globe.

Registration support : Supports registration applications from countries around the world.

Why choose HGH 191aa, made in China ?

Complete sequence : 191 complete amino acid sequence, with intact biological activity.

High purity : RP-HPLC purity ≥98%, SEC purity ≥99%

High activity : Bioactivity ≥3.0 IU/mg, accurate potency

Stable supply : Large-scale production capacity ensures timely and reliable delivery.

Summary

Made in China HGH 191aa 10IU lyophilized powder for injection represents the high-quality standard of recombinant growth hormone . Through advanced recombinant technology, rigorous quality control, and a stable cold chain supply system , it provides high-quality, highly active research tools for global endocrine disease and anti-aging research . Choosing Made in China means choosing professional quality and reliable assurance .

Need anything, please contact us