Description

Technical Parameters

TB500 (Thymosin β4) 2mg/bottle Core Introduction

Research -grade lyophilized powder | TB500 (Thymosin Beta-4) tissue repair peptide

Amino acid sequence : SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Molecular weight : 4963.5 Da

Purity : ≥98% (HPLC)

Specifications : 2mg/bottle

Appearance : White freeze-dried powder

Core Effects

TB500 is a synthetic tissue repair peptide that is widely used in sports injury repair, tissue regeneration research, and inflammation control due to its excellent wound healing and anti-inflammatory properties .

✅ Accelerate tissue repair :

Promote angiogenesis and accelerate wound and injury healing

Reduce scar formation and improve tissue function recovery

✅ Anti-inflammatory effect :

Inhibit inflammatory factors , reduce swelling and pain

Regulate immune response and improve chronic inflammation

✅ Sports Injury Recovery :

Accelerates muscle, tendon and ligament repair

Reduce recovery time and increase training frequency

Usage Protocol

1. Recombination method :

Use 1-2mL of bacteriostatic water to inject the peptide lyophilized powder bottle

Gently swirl until completely dissolved, avoid vigorous shaking

Storage after reconstitution : Refrigerate at 2-8°C and use within 7 days

2. Injection method :

Injection route : Subcutaneous injection (preferred) or intramuscular injection

Injection site :

Near the site of injury : Targeted local action

Subcutaneous injection in the abdomen : systemic effects

Injection dose : 2.0-2.5 mg/time

Injection frequency : 2 times a week (3-4 days apart)

3. When to use :

Immediately after injury : The optimal window for repair

Post- training use : Promotes recovery and adaptation

Use on an empty stomach : Avoid food that affects absorption

4. Injection technique :

Needle selection : 29-31G 0.5-inch insulin needle

Injection angle : 45 degrees (subcutaneous) or 90 degrees (intramuscular)

Slow injection : reduces pain and drug leakage

Treatment cycle plan

1. Acute injury repair :

Dosage : 2.5 mg twice a week

Duration : 4-6 weeks

Effect : Reduced injury healing time by 30-50%

2. Chronic inflammation management :

Dosage : 2.0 mg twice a week

Duration : 6-8 weeks

Effect : Significant reduction in inflammatory markers

3. Preventive use :

Dosage : 2.0 mg once a week

Application : High-risk sports injury prevention

4. Dosage adjustments :

Starting dose : 2.0 mg to test tolerance

Maintenance dose : 2.0-2.5 mg, adjusted based on response

Maximum dose : no more than 2.5 mg/time

Storage Guidelines

1. Unrestored :

Temperature : -20°C for long-term storage, 2-8°C for short-term storage

Humidity : Relative humidity ≤ 30%, desiccant protection

Light : Store away from light, in a brown bottle or wrapped in aluminum foil

Expiration date : 24 months at -20°C, 12 months at 2-8°C

2. Storage after reconstitution :

Use Immediately : For best results, use immediately after reconstitution

Store in refrigerator : 2-8°C for no more than 7 days

Avoid freezing : reconstituted solutions should not be repeatedly frozen and thawed

3. Transport Conditions :

Low temperature transport : ice pack insulation, temperature ≤ 4°C

Shockproof packaging : prevents severe vibrations from affecting the peptide structure

Fast delivery : Delivery within 48 hours to ensure activity

Why choose TB500?

One of the most potent tissue repair peptides , with significant effects

Multiple repair functions , promoting angiogenesis and anti-inflammation

High research value , ideal tool for studying tissue regeneration mechanisms

Quality Assurance :

GMP -compliant production , each batch HPLC purity tested (≥98% )

Third-party laboratory report (COA) is included with the goods

Sterile freeze-drying process to ensure no endotoxin

Worldwide Shipping :

Medical vial packaging , rubber stopper seal

Ice pack transportation to ensure peptide activity

Private delivery , no logo on the outer packaging

Conclusion

TB500 is an ideal tool for tissue repair and regeneration research , particularly for sports injury repair, chronic inflammation management, and angiogenesis research . The recommended dose is 2.0-2.5 mg/time, twice weekly .

Need a specific research plan ?

We provide professional technical guidance to help you conduct your research safely and efficiently!

Need anything, please contact us