Description

Technical Parameters

MGF (Mechano-Growth Factor) 2mg/vial Lyophilized Powder Product Introduction

Pharmaceutical Grade Freeze-Dried Powder | MGF (Mechano Growth Factor) Local Growth Factor

Amino acid sequence : YQPPSTNKNTKSQRRKGSTFEEHKNYSPLRWGLLP

Molecular weight : 2674.9 Da

Purity : ≥98% (HPLC)

Specifications : 2mg/bottle

Appearance : White freeze-dried powder

Usage

MGF (Mechano-Growth Factor) is a muscle-specific growth factor that is widely used in muscle injury repair, local muscle growth, and exercise recovery research due to its unique local repair and muscle hyperplasia effects .

✅ Targeted muscle repair :

Activate satellite cell proliferation and differentiation , promote muscle fiber repair

Local muscle hyperplasia , increasing the number and size of muscle fibers

✅ Accelerated Damage Recovery :

Significantly accelerates recovery from muscle strains and tears

Reduce scar tissue formation and maintain muscle elasticity

✅ Improved sports performance :

Increase muscle mass and strength to improve athletic performance

Reduce post-training muscle soreness and speed up recovery

MGF (Mechano-Growth Factor) Properties

Local effects :

Muscle tissue specific , does not enter the systemic circulation

Local hyperplasia at the injection site to avoid systemic side effects

Short half-life :

The half-life is about 5-10 minutes and requires immediate local application.

Fast -acting , directly targeting damaged muscle fibers

Preparation process :

Produced by genetic recombination technology , high purity and endotoxin-free

Lyophilization process to ensure peptide activity and stability

Safety Features :

No hormonal activity , no endocrine system disruption

Topical use , no systemic side effects

Precautions

⚠ Local reactions : May cause redness, swelling, or discomfort at the injection site (usually mild and short-lived)

⚠ When to use : Must be used immediately after training or injury

⚠ Injection technique : Must be injected into muscle tissue to avoid subcutaneous retention

Why choose MGF ?

The most effective local muscle repair factor , irreplaceable effect

Targeted effect to avoid systemic side effects

Sports medicine value , accelerating injury recovery and functional reconstruction

Quality Assurance :

GMP -compliant production , each batch HPLC purity tested (≥98% )

Third-party laboratory report (COA) is included with the product

Sterile freeze-drying process to ensure no endotoxin

Worldwide Shipping :

Medical vial packaging , rubber stopper seal

Ice pack transportation to ensure peptide activity

Private delivery , no logo on the outer packaging

Conclusion

MGF is a precise tool for muscle repair and local growth , particularly suitable for sports injury repair, local muscle development, and athletic recovery research . The recommended dose is 100-200mcg/time, 2-3 times per week .

Need a specific research plan ?

We provide professional technical guidance to help you conduct your research safely and efficiently!

If you need anything, please contact Allen