Description

Technical Parameters

GLP-1 5mg/bottle core introduction

Pharmaceutical-grade peptide formulation | Made in China GLP-1 (glucagon-like peptide-1)

Chemical names : Histidine-Alanine-Glutamic Acid-Glycine-Threonine-Phenylalanine-Threonine-Serine-Aspartic Acid-Valine-Serine-Tyrosine-Leucine-Glutamic Acid-Glycine-Glutamine-Alanine-Lysine-Glutamic Acid-Phenylalanine-Isoleucine-Alanine-Tryptophan-Leucine-Valine-Lysine-Glycine-Arginine-Glycine

Sequence : HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

CAS No .: 89750-14-1

Specification : 5mg/bottle

Dosage form : Lyophilized powder for injection

Molecular weight : 3298.6 Da

Appearance : White freeze-dried lumpy powder

Purity : ≥98% (HPLC detection)

Storage conditions : Store at -20℃ away from light.

Core Function | Core Effects

GLP-1 is an endogenous incretin hormone that is widely used in the treatment of type 2 diabetes, obesity management, and prevention of cardiovascular disease due to its multiple glucose-lowering mechanisms and cardiovascular protective effects .

✅Multiple mechanisms of action :

Glucose dependence : Promotes insulin secretion, with a lower risk of hypoglycemia.

Inhibit glucagon : Reduce hepatic glucose output and regulate blood sugar in both directions.

Central appetite suppression : Delays gastric emptying and increases satiety.

✅Quality advantages of Chinese manufacturing :

Purity Guaranteed : Solid-phase synthesis process, purity ≥98%, single impurities ≤0.1%.

Bioactivity : cAMP activity EC50 < 0.1 nM, stable titer

Excellent stability : Purity remains above 97% after 6 months of accelerated testing.

✅Global supply assurance :

Cold chain logistics : -20℃ cold chain transportation throughout the entire process to ensure product stability.

Multi-warehouse delivery : Regional warehouses are established in China, Europe, America, and the Asia-Pacific region, ensuring delivery within 7 days.

Customs clearance support : Professional document preparation ensures smooth customs clearance worldwide.

Production process and quality assurance

1. Advanced synthesis process :

Solid-phase synthesis : Microwave-assisted solid-phase synthesis technology was employed, with a condensation efficiency >99.8%.

Purification process : Preparative HPLC purification, gradient elution, collection of the main peak.

Freeze-drying technology : temperature-controlled freeze-drying, moisture content ≤3.0%.

2. Strict quality control standards :

Chemical purity :

Main component content: 98.0%~102.0%

Related substances: Single impurity ≤0.1%, total impurities ≤0.5%

Acetic acid content: ≤10.0% (ion chromatography)

Biological activity :

Cell viability assay: cAMP accumulation titer not less than 90% of the standard.

In vivo hypoglycemic activity: meets quality standards.

3. Stability data :

Long-term stability : Stored at -20℃ for 24 months, all indicators meet the requirements.

Accelerated testing : After being stored at 25°C for 6 months, the purity decreased by ≤2.0%.

Stability in use : After reconstitution, store at 2-8℃ for 7 days; purity ≥95%.

Clinical application and therapeutic advantages

1. Blood sugar lowering effect :

Powerful blood sugar lowering : HbA1c decreases by 1.0%~1.5%

Stable blood sugar : Reduces blood sugar fluctuations and lowers the risk of hypoglycemia.

β-cell protection : promotes β-cell proliferation and inhibits apoptosis.

2. Multiple benefits :

Weight control : Significant weight loss of 1.5~3.0 kg

Cardiovascular protection : Improves cardiovascular risk factors such as blood pressure and blood lipids.

Kidney protection : Reduces urinary protein excretion and slows the progression of kidney disease.

3. Security advantages :

Low risk of hypoglycemia : Glucose-dependent mechanism of action

Gastrointestinal tolerance : Common adverse reactions are mild and reversible

Cardiovascular safety : Large-scale studies confirm cardiovascular safety

Global supply and service assurance

1. Production capacity :

Annual production capacity : Over 1 kg per year

Flexible manufacturing : Customized specifications and packaging requirements are acceptable.

Production capacity assurance : Multiple production lines ensure stable supply

2. Quality Certification :

System Certification : Certified by ISO 9001 Quality Management System

Compliant with standards : Meets Chinese Pharmacopoeia, USP, and EP standards.

Complete documentation : Provides a complete package of quality documentation.

3. Logistics support :

Cryogenic packaging : Dry ice is used for transportation, and the temperature is maintained at -70℃ for ≥72 hours.

Real-time monitoring : Equipped with a temperature recorder, temperature data can be traced throughout the entire process.

Emergency Plan : Establish an emergency response mechanism for abnormal situations.

Why choose GLP-1 manufactured in China?

Multiple therapeutic effects : Lowering blood sugar, weight loss, and cardiovascular protection offer multiple benefits.

High safety profile : low risk of hypoglycemia due to glucose dependence.

Exceptional purity : Over 98% high purity, with strict quality control.

Stable supply : A complete supply chain ensures timely and reliable delivery.

Summarize

Made in China GLP-1 5mg lyophilized powder for injection represents the high-quality standard of incretin formulations . Through advanced manufacturing processes, rigorous quality control, and a stable supply system , it provides a high-quality, high-efficiency product option for the treatment of diabetes and metabolic diseases worldwide . Choosing Made in China means choosing professional quality and reliable assurance .

Need product information or clinical support?

Feel free to contact our professional team for technical support!

Need anything, please contact us