Description

Technical Parameters

IGF -1 LR3 (Long-Acting Insulin-Like Growth Factor) 1mg/bottle Core Introduction

Research -grade lyophilized powder | Long R3 Insulin-like Growth Factor-1 (LIGF-1) modified peptide

Amino acid sequence : MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (70 amino acids, including a 13 amino acid extended peptide)

Molecular weight : 7,649 Da

Purity : ≥97% (HPLC)

Specifications : 1mg/bottle (approximately 130nmol)

Appearance : White freeze-dried powder

Solvent : 1mL bacteriostatic water

Core Effects

IGF-1 LR3 is a long-acting modified insulin-like growth factor (IGF ) that is widely used in muscle growth research, metabolic disease treatment, and tissue repair applications due to its excellent growth-promoting properties and metabolic regulation functions .

✅ Powerful muscle growth :

Activates IGF-1 receptors , promoting protein synthesis and muscle cell proliferation

Increase the number and volume of muscle fibers to achieve qualitative muscle growth

✅ Metabolic regulation advantages :

Mimetic insulin action , enhancing glucose and amino acid uptake

Promote fat decomposition and optimize body composition ratio

✅ Long-lasting properties :

Half-life extended to 20-30 hours (compared to natural IGF-1, which is only 2-4 hours)

Stable blood drug concentration , reducing the frequency of dosing

✅ Tissue repair function :

Accelerates cartilage, bone and nerve tissue repair

Reduce inflammatory response and promote injury recovery

Usage Protocol

1. Recombination method :

Use 1mL of bacteriostatic water to slowly inject into the wall of the freeze-dried powder bottle

Gently swirl until completely dissolved; avoid vigorous shaking or vortexing

Storage after reconstitution : Refrigerate at 2-8°C and use within 7 days

2. Injection method :

Injection route : Subcutaneous injection (preferred) or intramuscular injection

Injection site :

Abdomen : Subcutaneous fat layer around the umbilicus (most stable absorption)

Targeted muscle groups : Local injections enhance targeting

Injection dose :

Muscle growth studies : 20-50mcg/day

Metabolic studies : 10-30 mcg/day

Topical application : 5-20mcg/target muscle

Injection frequency : once a day

3. Injection technique :

Needle options : 29-31G 0.5-inch insulin needle

Injection Angle : 45 degrees subcutaneous injection

Injection speed : Slow push (10-15 seconds/0.1mL)

Site rotation : Regularly change the injection site

4. When to use :

Use immediately after training : Promotes nutrient absorption and muscle repair

Use in the morning on an empty stomach : Enhances metabolic regulation

Local Targeted Use : Development of specific muscle groups

Storage Guidelines

1. Unrestored :

Temperature : -20°C for long-term storage, 2-8°C for short-term storage

Humidity : Relative humidity ≤ 30%, desiccant protection

Light : Store away from light, in brown glass bottle or wrapped in aluminum foil

Expiration date : 24 months at -20°C, 12 months at 2-8°C

2. Storage after reconstitution :

Use Immediately : For best results, use immediately after reconstitution

Store in refrigerator : 2-8°C for no more than 7 days

Avoid freezing : reconstituted solutions should not be frozen or thawed repeatedly

3. Transportation conditions :

Ultra- low temperature transportation : Dry ice transportation (-78°C)

Shockproof packaging : prevents severe vibrations from affecting protein structure

Fast delivery : Delivery within 48 hours to ensure activity

Why choose IGF-1 LR3?

One of the most potent growth-promoting peptides with significant effects

Long-lasting properties , reducing dosing frequency and improving convenience

Multiple biological functions , including growth, metabolism and repair

Quality Assurance :

GMP -compliant production , each batch HPLC purity tested (≥97% )

Third-party laboratory report (COA) is included with the goods

Endotoxin detection (<1.0EU/mg)

Worldwide Shipping :

Medical vial packaging , rubber stopper seal

Dry ice transportation to ensure protein activity

Private delivery , no logo on the outer packaging

Conclusion

IGF-1 LR3 is an advanced tool for muscle growth and metabolism research , particularly suitable for studying the mechanisms of muscle hyperplasia, metabolic disease treatment, and tissue repair . The recommended dose is 20-50mcg/day .

Need anything, please contact us