Description

Technical Parameters

GLP -1 (Glucagon-like peptide-1) 5mg/bottle Core Introduction

Research -grade lyophilized powder | Glucagon-Like Peptide-1 (GLP-1) incretin peptide

Amino acid sequence : HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (amidated)

Molecular weight : approximately 3,300 Da

Purity : ≥97% (HPLC)

Specifications : 5mg/bottle

Appearance : White freeze-dried powder

Solvent : 1mL bacteriostatic water

Core Effects

Glucagon-like peptide-1 (GLP-1) is an incretin hormone secreted by intestinal L cells . Due to its multiple blood sugar regulation and metabolic improvement properties , it is widely used in the treatment of type 2 diabetes, obesity management, and cardiovascular protection research .

✅ Glucose-dependent hypoglycemic effect :

Stimulates insulin secretion : Promotes insulin release only when blood sugar rises

Inhibit glucagon : Reduce liver glucose output, lower fasting and postprandial blood sugar

✅ Multiple metabolic regulation :

Delaying gastric emptying : Prolonging nutrient absorption time and stabilizing postprandial blood sugar

Central appetite suppression : Increases satiety and reduces food intake

✅ Cardiovascular protection :

Improved endothelial function : Protecting vascular integrity

Anti- atherosclerosis : Reduces vascular inflammation and plaque formation

✅ Advantages :

Glucose- dependent effects : Significantly reduced risk of hypoglycemia

Multiple benefits : blood sugar reduction, weight loss, and cardiovascular protection

Usage Protocol

1. Recombination method :

Use 1mL of bacteriostatic water to slowly inject into the wall of the freeze-dried powder bottle

Swirl gently until completely dissolved; avoid vigorous shaking or vortexing

Storage after reconstitution : Refrigerate at 2-8°C and use within 7 days

2. Injection method :

Injection route : Subcutaneous injection (preferably into the abdomen, thigh, or upper arm)

Injection dose :

Starting dose : 0.6 mg/day for 1 week

Increase dose : Increase by 0.6 mg per week until the maintenance dose is reached

Maintenance dose : 1.2-1.8 mg/day

Injection time : Any fixed time every day, before or after meals

3. Treatment options :

Type 2 diabetes treatment :

Use alone or in combination with other hypoglycemic drugs

Individualized dosage adjustment based on blood glucose monitoring results

Obesity Management :

Combining diet and exercise

Sustainable weight loss effect with long-term use

Storage Guidelines

1. Unrestored :

Temperature : -20°C for long-term storage, 2-8°C for short-term storage

Humidity : Relative humidity ≤ 30%, desiccant protection

Light : Store away from light, in brown glass bottle or wrapped in aluminum foil

Expiration date : 24 months at -20°C, 12 months at 2-8°C

2. Storage after reconstitution :

Use Immediately : For best results, use immediately after reconstitution

Store in refrigerator : 2-8°C for no more than 7 days

Avoid freezing : reconstituted solutions should not be repeatedly frozen and thawed

3. Transport Conditions :

Ultra- low temperature transport : dry ice transport (-78°C)

Shockproof packaging : prevents severe vibrations from affecting the peptide structure

Fast delivery : Delivery within 48 hours to ensure activity

Why GLP-1 ?

Glucose-dependent hypoglycemic effect , significantly safer than traditional hypoglycemic drugs

Multiple metabolic benefits , including blood sugar lowering, weight loss, and cardiovascular protection

Sufficient clinical evidence , and large-scale studies have confirmed long-term benefits

Quality Assurance :

GMP -compliant production , each batch HPLC purity tested (≥97% )

Third-party laboratory report (COA) is included with the goods

Sterile freeze-drying process to ensure no endotoxin

Global Shipping :

Medical vial packaging , rubber stopper seal

Dry ice transportation to ensure peptide activity

Private delivery , no logo on the outer packaging

Conclusion

GLP-1 is an important tool for diabetes management and metabolic research , particularly for type 2 diabetes treatment, obesity management, and cardiovascular metabolic disease research . The recommended dose is 1.2-1.8 mg/day .

Need a specific research plan ?

We provide professional technical guidance to help you conduct your research safely and efficiently!

Need anything, please contact us